Recombinant Full Length Human HLA-C Protein, GST-tagged
Cat.No. : | HLA-C-3560HF |
Product Overview : | Human HLA-C full-length ORF (1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 336 amino acids |
Description : | HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Over one hundred HLA-C alleles have been described [provided by RefSeq |
Molecular Mass : | 63.8 kDa |
AA Sequence : | MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAAQITQRKLEASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWAPGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQGPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HLA-C major histocompatibility complex, class I, C [ Homo sapiens ] |
Official Symbol | HLA-C |
Synonyms | major histocompatibility complex, class I, C; 4933; Ensembl:ENSG00000204525; FLJ27082; HLA class I histocompatibility antigen, Cw-1 alpha chain;MHC class I antigen heavy chain HLA-C;human leukocyte antigen-C alpha chain;major histocompatibility antigen HLA-C;HLA class I histocompatibility antigen, C alpha chain; HLC-C; D6S204; PSORS1; HLA-JY3 |
Gene ID | 3107 |
mRNA Refseq | NM_001243042 |
Protein Refseq | NP_001229971 |
MIM | 142840 |
UniProt ID | O19617 |
◆ Recombinant Proteins | ||
HLA-C-4834H | Recombinant Human HLA-C Protein, GST-tagged | +Inquiry |
HLA-C-242H | Recombinant Human HLA-C Protein, His-tagged | +Inquiry |
HLA-C-2940H | Recombinant Human HLA-C Protein (Ser48-Thr305), His tagged | +Inquiry |
HLA-C-3560HF | Recombinant Full Length Human HLA-C Protein, GST-tagged | +Inquiry |
HLA-C-13811H | Recombinant Human HLA-C, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-C-5498HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-C Products
Required fields are marked with *
My Review for All HLA-C Products
Required fields are marked with *
0
Inquiry Basket