Recombinant Full Length Human HMBS Protein, GST-tagged
Cat.No. : | HMBS-3636HF |
Product Overview : | Human HMBS full-length ORF ( AAH00520.1, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 361 amino acids |
Description : | This gene encodes a member of the hydroxymethylbilane synthase superfamily. The encoded protein is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq |
Molecular Mass : | 65.45 kDa |
AA Sequence : | MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKIPDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLNDAH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HMBS hydroxymethylbilane synthase [ Homo sapiens ] |
Official Symbol | HMBS |
Synonyms | HMBS; hydroxymethylbilane synthase; PBGD, PORC, porphobilinogen deaminase , porphyria, acute; Chester type , UPS, uroporphyrinogen I synthase; porphobilinogen deaminase; uroporphyrinogen I synthase; pre-uroporphyrinogen synthase; uroporphyrinogen I synthetase; porphyria, acute; Chester type; UPS; PBGD; PORC; PBG-D; |
Gene ID | 3145 |
mRNA Refseq | NM_000190 |
Protein Refseq | NP_000181 |
MIM | 609806 |
UniProt ID | P08397 |
◆ Recombinant Proteins | ||
HMBS-3636HF | Recombinant Full Length Human HMBS Protein, GST-tagged | +Inquiry |
HMBS-3347H | Recombinant Human HMBS protein, His-tagged | +Inquiry |
HMBS-13835H | Recombinant Human HMBS, GST-tagged | +Inquiry |
HMBS-1374HFL | Recombinant Full Length Human HMBS Protein, C-Flag-tagged | +Inquiry |
HMBS-39H | Recombinant Human HMBS protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMBS-5483HCL | Recombinant Human HMBS 293 Cell Lysate | +Inquiry |
HMBS-5484HCL | Recombinant Human HMBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMBS Products
Required fields are marked with *
My Review for All HMBS Products
Required fields are marked with *