Recombinant Full Length Human HMGN4 Protein, GST-tagged
| Cat.No. : | HMGN4-3662HF |
| Product Overview : | Human HMGN4 full-length ORF ( AAH01282, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 90 amino acids |
| Description : | The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HMGN4 high mobility group nucleosomal binding domain 4 [ Homo sapiens ] |
| Official Symbol | HMGN4 |
| Synonyms | HMGN4; high mobility group nucleosomal binding domain 4; high mobility group (nonhistone chromosomal) protein 17 like 3 , HMG17L3; high mobility group nucleosome-binding domain-containing protein 4; NHC; high mobility group protein N4; high-mobility group protein 17-like 3; non-histone chromosomal protein HMG-17-like 3; high-mobility group (nonhistone chromosomal) protein 17-like 3; HMG17L3; MGC5145; |
| Gene ID | 10473 |
| mRNA Refseq | NM_006353 |
| Protein Refseq | NP_006344 |
| UniProt ID | O00479 |
| ◆ Recombinant Proteins | ||
| HMGN4-4882H | Recombinant Human HMGN4 Protein, GST-tagged | +Inquiry |
| HMGN4-3662HF | Recombinant Full Length Human HMGN4 Protein, GST-tagged | +Inquiry |
| HMGN4-2523H | Recombinant Human HMGN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HMGN4-1931R | Recombinant Rhesus Macaque HMGN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HMGN4-13852H | Recombinant Human HMGN4, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGN4-5471HCL | Recombinant Human HMGN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGN4 Products
Required fields are marked with *
My Review for All HMGN4 Products
Required fields are marked with *
