Recombinant Human HMGN4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HMGN4-2523H |
Product Overview : | HMGN4 MS Standard C13 and N15-labeled recombinant protein (NP_006344) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. |
Molecular Mass : | 9.5 kDa |
AA Sequence : | MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HMGN4 high mobility group nucleosomal binding domain 4 [ Homo sapiens (human) ] |
Official Symbol | HMGN4 |
Synonyms | HMGN4; high mobility group nucleosomal binding domain 4; high mobility group (nonhistone chromosomal) protein 17 like 3, HMG17L3; high mobility group nucleosome-binding domain-containing protein 4; NHC; high mobility group protein N4; high-mobility group protein 17-like 3; non-histone chromosomal protein HMG-17-like 3; high-mobility group (nonhistone chromosomal) protein 17-like 3; HMG17L3; MGC5145; |
Gene ID | 10473 |
mRNA Refseq | NM_006353 |
Protein Refseq | NP_006344 |
UniProt ID | O00479 |
◆ Recombinant Proteins | ||
HMGN4-2523H | Recombinant Human HMGN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HMGN4-4882H | Recombinant Human HMGN4 Protein, GST-tagged | +Inquiry |
HMGN4-13852H | Recombinant Human HMGN4, GST-tagged | +Inquiry |
HMGN4-2110R | Recombinant Rhesus monkey HMGN4 Protein, His-tagged | +Inquiry |
HMGN4-3662HF | Recombinant Full Length Human HMGN4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGN4-5471HCL | Recombinant Human HMGN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGN4 Products
Required fields are marked with *
My Review for All HMGN4 Products
Required fields are marked with *