Recombinant Human HMGN4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HMGN4-2523H
Product Overview : HMGN4 MS Standard C13 and N15-labeled recombinant protein (NP_006344) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates.
Molecular Mass : 9.5 kDa
AA Sequence : MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HMGN4 high mobility group nucleosomal binding domain 4 [ Homo sapiens (human) ]
Official Symbol HMGN4
Synonyms HMGN4; high mobility group nucleosomal binding domain 4; high mobility group (nonhistone chromosomal) protein 17 like 3, HMG17L3; high mobility group nucleosome-binding domain-containing protein 4; NHC; high mobility group protein N4; high-mobility group protein 17-like 3; non-histone chromosomal protein HMG-17-like 3; high-mobility group (nonhistone chromosomal) protein 17-like 3; HMG17L3; MGC5145;
Gene ID 10473
mRNA Refseq NM_006353
Protein Refseq NP_006344
UniProt ID O00479

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGN4 Products

Required fields are marked with *

My Review for All HMGN4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon