Recombinant Full Length Human HMP19 Protein, GST-tagged
| Cat.No. : | HMP19-3668HF |
| Product Overview : | Human HMP19 full-length ORF ( AAH02619, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 171 amino acids |
| Description : | HMP19 (HMP19 Protein) is a Protein Coding gene. GO annotations related to this gene include clathrin light chain binding. An important paralog of this gene is NSG1. |
| Molecular Mass : | 44.55 kDa |
| AA Sequence : | MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HMP19 HMP19 protein [ Homo sapiens ] |
| Official Symbol | HMP19 |
| Synonyms | HMP19; HMP19 protein; neuron-specific protein family member 2; NSG2; p19 protein; protein p19; hypothalamus golgi apparatus expressed 19 kDa protein; |
| Gene ID | 51617 |
| mRNA Refseq | NM_015980 |
| Protein Refseq | NP_057064 |
| MIM | 616752 |
| UniProt ID | Q9Y328 |
| ◆ Recombinant Proteins | ||
| HMP19-3301H | Recombinant Human HMP19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HMP19-4887H | Recombinant Human HMP19 Protein, GST-tagged | +Inquiry |
| HMP19-3668HF | Recombinant Full Length Human HMP19 Protein, GST-tagged | +Inquiry |
| HMP19-13857H | Recombinant Human HMP19, GST-tagged | +Inquiry |
| HMP19-11121Z | Recombinant Zebrafish HMP19 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMP19-5465HCL | Recombinant Human HMP19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMP19 Products
Required fields are marked with *
My Review for All HMP19 Products
Required fields are marked with *
