Recombinant Full Length Human HNRNPA1P8 Protein, GST-tagged
Cat.No. : | HNRNPA1P8-3509HF |
Product Overview : | Human hCG_2023776 full-length ORF ( XP_208373.5, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 317 amino acids |
Description : | HNRNPA1P8 (Heterogeneous Nuclear Ribonucleoprotein A1 Pseudogene 8) is a Pseudogene. |
Molecular Mass : | 60.3 kDa |
AA Sequence : | MSKSESPKEPKQLRKLFIGGLSFETTNESLRSHFEQWGTLMDCVVMRDPNTKCSRGFGFVTYATVEEVDAAMNARPHKVDGRVVESKRAVSREDSQRPGAHLTVKKIFVGGIKEDTKEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHICEVRKALSKQEMASTSSSQRGQSGSGNFSGGRGGGFSGNDNFGHGGNFSGRGGFGGSRGAGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFRPMKGGNFGGRSSGPYGGGGNTLQNQGGYGSSSSSSSYGSGRRF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HNRNPA1P8 heterogeneous nuclear ribonucleoprotein A1 pseudogene 8 [ Homo sapiens (human) ] |
Official Symbol | HNRNPA1P8 |
Synonyms | HNRNPA1P8; heterogeneous nuclear ribonucleoprotein A1 pseudogene 8; hCG2023776 |
Gene ID | 402562 |
◆ Recombinant Proteins | ||
HNRNPA1P8-4623H | Recombinant Human HNRNPA1P8 Protein, GST-tagged | +Inquiry |
HNRNPA1P8-3509HF | Recombinant Full Length Human HNRNPA1P8 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPA1P8 Products
Required fields are marked with *
My Review for All HNRNPA1P8 Products
Required fields are marked with *