Recombinant Human HNRNPA1P8 Protein, GST-tagged

Cat.No. : HNRNPA1P8-4623H
Product Overview : Human hCG_2023776 full-length ORF ( XP_208373.5, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HNRNPA1P8 (Heterogeneous Nuclear Ribonucleoprotein A1 Pseudogene 8) is a Pseudogene.
Molecular Mass : 60.3 kDa
AA Sequence : MSKSESPKEPKQLRKLFIGGLSFETTNESLRSHFEQWGTLMDCVVMRDPNTKCSRGFGFVTYATVEEVDAAMNARPHKVDGRVVESKRAVSREDSQRPGAHLTVKKIFVGGIKEDTKEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHICEVRKALSKQEMASTSSSQRGQSGSGNFSGGRGGGFSGNDNFGHGGNFSGRGGFGGSRGAGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFRPMKGGNFGGRSSGPYGGGGNTLQNQGGYGSSSSSSSYGSGRRF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HNRNPA1P8 heterogeneous nuclear ribonucleoprotein A1 pseudogene 8 [ Homo sapiens (human) ]
Official Symbol HNRNPA1P8
Synonyms HNRNPA1P8; heterogeneous nuclear ribonucleoprotein A1 pseudogene 8; hCG2023776
Gene ID 402562

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNRNPA1P8 Products

Required fields are marked with *

My Review for All HNRNPA1P8 Products

Required fields are marked with *

0
cart-icon