Recombinant Full Length Human HOXA6 Protein, GST-tagged
Cat.No. : | HOXA6-3712HF |
Product Overview : | Human HOXA6 full-length ORF ( NP_076919.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 233 amino acids |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq |
Molecular Mass : | 52.7 kDa |
AA Sequence : | MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAKAGE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXA6 homeobox A6 [ Homo sapiens ] |
Official Symbol | HOXA6 |
Synonyms | HOXA6; homeobox A6; homeo box A6 , HOX1, HOX1B; homeobox protein Hox-A6; homeo box 1B; homeo box A6; homeobox protein HOXA6; homeobox protein Hox-1B; HOX1; HOX1B; HOX1.2; |
Gene ID | 3203 |
mRNA Refseq | NM_024014 |
Protein Refseq | NP_076919 |
MIM | 142951 |
UniProt ID | P31267 |
◆ Recombinant Proteins | ||
HOXA6-4948H | Recombinant Human HOXA6 Protein, GST-tagged | +Inquiry |
HOXA6-2671C | Recombinant Chicken HOXA6 | +Inquiry |
HOXA6-140H | Recombinant Human HOXA6 Protein, HIS-tagged | +Inquiry |
HOXA6-4282M | Recombinant Mouse HOXA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA6-3712HF | Recombinant Full Length Human HOXA6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXA6-5424HCL | Recombinant Human HOXA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXA6 Products
Required fields are marked with *
My Review for All HOXA6 Products
Required fields are marked with *