Recombinant Full Length Human HOXC9 Protein, GST-tagged

Cat.No. : HOXC9-3730HF
Product Overview : Human HOXC9 full-length ORF ( AAH53894, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 260 amino acids
Description : This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq
Molecular Mass : 54.34 kDa
AA Sequence : MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXC9 homeobox C9 [ Homo sapiens ]
Official Symbol HOXC9
Synonyms HOXC9; homeobox C9; homeo box C9 , HOX3, HOX3B; homeobox protein Hox-C9; homeo box C9; homeobox protein Hox-3B; HOX3; HOX3B;
Gene ID 3225
mRNA Refseq NM_006897
Protein Refseq NP_008828
MIM 142971
UniProt ID P31274

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXC9 Products

Required fields are marked with *

My Review for All HOXC9 Products

Required fields are marked with *

0
cart-icon