Recombinant Full Length Human HOXD10 Protein, GST-tagged
| Cat.No. : | HOXD10-3732HF |
| Product Overview : | Human HOXD10 full-length ORF ( NP_002139.2, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 340 amino acids |
| Description : | This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilms tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. [provided by RefSeq |
| Molecular Mass : | 64.8 kDa |
| AA Sequence : | MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HOXD10 homeobox D10 [ Homo sapiens ] |
| Official Symbol | HOXD10 |
| Synonyms | HOXD10; homeobox D10; homeo box D10 , HOX4, HOX4D; homeobox protein Hox-D10; homeo box 4D; homeo box D10; homeobox protein Hox-4D; homeobox protein Hox-4E; HOX4; HOX4D; HOX4E; Hox-4.4; |
| Gene ID | 3236 |
| mRNA Refseq | NM_002148 |
| Protein Refseq | NP_002139 |
| MIM | 142984 |
| UniProt ID | P28358 |
| ◆ Recombinant Proteins | ||
| HOXD10-3732HF | Recombinant Full Length Human HOXD10 Protein, GST-tagged | +Inquiry |
| HOXD10-26460TH | Recombinant Human HOXD10 | +Inquiry |
| HOXD10-4990H | Recombinant Human HOXD10 Protein, GST-tagged | +Inquiry |
| HOXD10-714H | Recombinant Human HOXD10 Protein, His-tagged | +Inquiry |
| HOXD10-3653H | Recombinant Human HOXD10 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HOXD10-5412HCL | Recombinant Human HOXD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXD10 Products
Required fields are marked with *
My Review for All HOXD10 Products
Required fields are marked with *
