Recombinant Full Length Human HPN Protein
Cat.No. : | HPN-240HF |
Product Overview : | Recombinant full length Human Hepsin with a N terminal proprietary tag. Predicted MW 67.69kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a type II transmembrane serine protease. The encoded protein has an extracellular region that consists of two domains, a catalytic serine protease domain and a non-catalytic scavenger receptor cysteine-rich domain. This protein may be involved in diverse cellular functions including blood coagulation, maintenance of cell morphology and the growth and progression of certain cancers, particularly prostate cancer. Alternative splicing results in multiple transcript variants. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 67.690kDa inclusive of tags |
Protein Length : | 378 amino acids |
AA Sequence : | VAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSS RSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFC VDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLP VDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVL TAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVY HGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLP AAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISN DVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFAC EDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREW IFQAIKTHSEASGMVTQL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | HPN hepsin [ Homo sapiens ] |
Official Symbol : | HPN |
Synonyms : | HPN; hepsin; serine protease hepsin; TMPRSS1; transmembrane protease; serine 1 |
Gene ID : | 3249 |
mRNA Refseq : | NM_002151 |
Protein Refseq : | NP_002142 |
MIM : | 142440 |
UniProt ID : | P05981 |
Products Types
◆ Recombinant Protein | ||
HPN-5010H | Recombinant Human HPN Protein, GST-tagged | +Inquiry |
HPN-2559R | Recombinant Rat HPN Protein, His (Fc)-Avi-tagged | +Inquiry |
HPN-3121H | Recombinant Human HPN Protein, His (Fc)-Avi-tagged | +Inquiry |
HPN-4308M | Recombinant Mouse HPN Protein, His (Fc)-Avi-tagged | +Inquiry |
HPN-148H | Active Recombinant Human HPN Protein, His-tagged | +Inquiry |
◆ Lysates | ||
HPN-5400HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
HPN-5399HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket