Recombinant Full Length Human HPS3 Protein, GST-tagged
| Cat.No. : | HPS3-3630HF |
| Product Overview : | Human HPS3 full-length ORF ( AAH16901.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 372 amino acids |
| Description : | This gene encodes a protein containing a potential clathrin-binding motif, consensus dileucine signals, and tyrosine-based sorting signals for targeting to vesicles of lysosomal lineage. The encoded protein may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 3. Alternate splice variants exist, but their full length sequence has not been determined. [provided by RefSeq |
| Molecular Mass : | 68.7 kDa |
| AA Sequence : | MFYVAEPKQVPHILCSPSMKNINPLTAMSYLRKLDTSGFSSILVTLTKAAVALKMGDLDMHRNEMKSHSEMKLVCGFILEPRLLIQQRKGQIVPTELALHLKETQPGLLVASVLGLQKNNKIGIEEADSFFKVLCAKDEDTIPQLLVDFWEAQLVACLPDVVLQELFFKLTSQYIWRLSKRQPPDTTPLRTSEDLINACSHYGLIYPWVHVVISSDSLADKNYTEDLSKLQSLICGPSFDIASIIPFLEPLSEDTIAGLSVHVLCRTRLKEYEQCIDILLERCPEAVIPYANHELKEENRTLWWKKLLPELCQRIKCGGEKYQLYLSSLKETLSIVAVELELKDFMNVLPEDGTATFFLPYLLYCSRKKPLT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HPS3 Hermansky-Pudlak syndrome 3 [ Homo sapiens ] |
| Official Symbol | HPS3 |
| Synonyms | HPS3; Hermansky-Pudlak syndrome 3; Hermansky-Pudlak syndrome 3 protein; SUTAL; FLJ22704; DKFZp686F0413; |
| Gene ID | 84343 |
| mRNA Refseq | NM_032383 |
| Protein Refseq | NP_115759 |
| MIM | 606118 |
| UniProt ID | Q969F9 |
| ◆ Recombinant Proteins | ||
| HPS3-5015H | Recombinant Human HPS3 Protein, GST-tagged | +Inquiry |
| HPS3-3630HF | Recombinant Full Length Human HPS3 Protein, GST-tagged | +Inquiry |
| HPS3-13926H | Recombinant Human HPS3, GST-tagged | +Inquiry |
| HPS3-7790Z | Recombinant Zebrafish HPS3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HPS3-5396HCL | Recombinant Human HPS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPS3 Products
Required fields are marked with *
My Review for All HPS3 Products
Required fields are marked with *
