Recombinant Full Length Human HPS3 Protein, GST-tagged
Cat.No. : | HPS3-3630HF |
Product Overview : | Human HPS3 full-length ORF ( AAH16901.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 372 amino acids |
Description : | This gene encodes a protein containing a potential clathrin-binding motif, consensus dileucine signals, and tyrosine-based sorting signals for targeting to vesicles of lysosomal lineage. The encoded protein may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 3. Alternate splice variants exist, but their full length sequence has not been determined. [provided by RefSeq |
Molecular Mass : | 68.7 kDa |
AA Sequence : | MFYVAEPKQVPHILCSPSMKNINPLTAMSYLRKLDTSGFSSILVTLTKAAVALKMGDLDMHRNEMKSHSEMKLVCGFILEPRLLIQQRKGQIVPTELALHLKETQPGLLVASVLGLQKNNKIGIEEADSFFKVLCAKDEDTIPQLLVDFWEAQLVACLPDVVLQELFFKLTSQYIWRLSKRQPPDTTPLRTSEDLINACSHYGLIYPWVHVVISSDSLADKNYTEDLSKLQSLICGPSFDIASIIPFLEPLSEDTIAGLSVHVLCRTRLKEYEQCIDILLERCPEAVIPYANHELKEENRTLWWKKLLPELCQRIKCGGEKYQLYLSSLKETLSIVAVELELKDFMNVLPEDGTATFFLPYLLYCSRKKPLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HPS3 Hermansky-Pudlak syndrome 3 [ Homo sapiens ] |
Official Symbol | HPS3 |
Synonyms | HPS3; Hermansky-Pudlak syndrome 3; Hermansky-Pudlak syndrome 3 protein; SUTAL; FLJ22704; DKFZp686F0413; |
Gene ID | 84343 |
mRNA Refseq | NM_032383 |
Protein Refseq | NP_115759 |
MIM | 606118 |
UniProt ID | Q969F9 |
◆ Recombinant Proteins | ||
HPS3-7790Z | Recombinant Zebrafish HPS3 | +Inquiry |
HPS3-5015H | Recombinant Human HPS3 Protein, GST-tagged | +Inquiry |
HPS3-13926H | Recombinant Human HPS3, GST-tagged | +Inquiry |
HPS3-3630HF | Recombinant Full Length Human HPS3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPS3-5396HCL | Recombinant Human HPS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HPS3 Products
Required fields are marked with *
My Review for All HPS3 Products
Required fields are marked with *
0
Inquiry Basket