Recombinant Full Length Human HSD17B2 Protein, C-Flag-tagged

Cat.No. : HSD17B2-99HFL
Product Overview : Recombinant Full Length Human HSD17B2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 42.6 kDa
AA Sequence : MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYT YLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDIT KPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLE KDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL
AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKATTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transmembrane
Protein Pathways : Androgen and estrogen metabolism, Metabolic pathways
Full Length : Full L.
Gene Name HSD17B2 hydroxysteroid 17-beta dehydrogenase 2 [ Homo sapiens (human) ]
Official Symbol HSD17B2
Synonyms HSD17; SDR9C2; EDH17B2
Gene ID 3294
mRNA Refseq NM_002153.3
Protein Refseq NP_002144.1
MIM 109685
UniProt ID P37059

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B2 Products

Required fields are marked with *

My Review for All HSD17B2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon