Recombinant Full Length Human HSD17B7 Protein, C-Flag-tagged
Cat.No. : | HSD17B7-1470HFL |
Product Overview : | Recombinant Full Length Human HSD17B7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | HSD17B7 encodes an enzyme that functions both as a 17-beta-hydroxysteroid dehydrogenase (EC 1.1.1.62) in the biosynthesis of sex steroids and as a 3-ketosteroid reductase (EC 1.1.1.270) in the biosynthesis of cholesterol. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38 kDa |
AA Sequence : | MRKVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIVQVDVSNLQSV FRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTAEGLLTQGDKITADGLQEVFE TNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYATDLLSVALNRN FNQQGLYSNVACPGTALTNLTYGILPPFIWTLLMPAILLLRFFANAFTLTPYNGTEALVWLFHQKPESLN PLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Androgen and estrogen metabolism, Metabolic pathways, Steroid biosynthesis |
Full Length : | Full L. |
Gene Name | HSD17B7 hydroxysteroid 17-beta dehydrogenase 7 [ Homo sapiens (human) ] |
Official Symbol | HSD17B7 |
Synonyms | PRAP; SDR37C1 |
Gene ID | 51478 |
mRNA Refseq | NM_016371.4 |
Protein Refseq | NP_057455.1 |
MIM | 606756 |
UniProt ID | P56937 |
◆ Recombinant Proteins | ||
HSD17B7-4899C | Recombinant Chicken HSD17B7 | +Inquiry |
HSD17B7-4338M | Recombinant Mouse HSD17B7 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B7-1108H | Recombinant Human HSD17B7 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B7-348C | Recombinant Cynomolgus Monkey HSD17B7 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B7-4686Z | Recombinant Zebrafish HSD17B7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B7-819HCL | Recombinant Human HSD17B7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B7 Products
Required fields are marked with *
My Review for All HSD17B7 Products
Required fields are marked with *
0
Inquiry Basket