Recombinant Full Length Human HSD17B8 Protein, C-Flag-tagged
Cat.No. : | HSD17B8-1069HFL |
Product Overview : | Recombinant Full Length Human HSD17B8 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.8 kDa |
AA Sequence : | MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHA AFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQ ALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Androgen and estrogen metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | HSD17B8 hydroxysteroid 17-beta dehydrogenase 8 [ Homo sapiens (human) ] |
Official Symbol | HSD17B8 |
Synonyms | KE6; FABG; HKE6; FABGL; RING2; H2-KE6; SDR30C1; D6S2245E; dJ1033B10.9 |
Gene ID | 7923 |
mRNA Refseq | NM_014234.5 |
Protein Refseq | NP_055049.1 |
MIM | 601417 |
UniProt ID | Q92506 |
◆ Recombinant Proteins | ||
HSD17B8-1393Z | Recombinant Zebrafish HSD17B8 | +Inquiry |
HSD17B8-5076H | Recombinant Human HSD17B8 Protein, GST-tagged | +Inquiry |
HSD17B8-603C | Recombinant Cynomolgus HSD17B8 Protein, His-tagged | +Inquiry |
HSD17B8-1069HFL | Recombinant Full Length Human HSD17B8 Protein, C-Flag-tagged | +Inquiry |
HSD17B8-2931R | Recombinant Rat HSD17B8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B8-5371HCL | Recombinant Human HSD17B8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B8 Products
Required fields are marked with *
My Review for All HSD17B8 Products
Required fields are marked with *
0
Inquiry Basket