Recombinant Full Length Human HSDL2 Protein, GST-tagged
Cat.No. : | HSDL2-3886HF |
Product Overview : | Human HSDL2 full-length ORF ( NP_115679.2, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 418 amino acids |
Description : | HSDL2 (Hydroxysteroid Dehydrogenase Like 2) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity. |
Molecular Mass : | 71.8 kDa |
AA Sequence : | MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSDL2 hydroxysteroid dehydrogenase like 2 [ Homo sapiens ] |
Official Symbol | HSDL2 |
Synonyms | HSDL2; hydroxysteroid dehydrogenase like 2; C9orf99, chromosome 9 open reading frame 99; hydroxysteroid dehydrogenase-like protein 2; SDR13C1; short chain dehydrogenase/reductase family 13C; member 1; short chain dehydrogenase/reductase family 13C, member 1; C9orf99; FLJ25855; MGC10940; |
Gene ID | 84263 |
mRNA Refseq | NM_001195822 |
Protein Refseq | NP_001182751 |
UniProt ID | Q6YN16 |
◆ Recombinant Proteins | ||
HSDL2-4345M | Recombinant Mouse HSDL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSDL2-1112H | Recombinant Human HSDL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSDL2-1980R | Recombinant Rhesus Macaque HSDL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSDL2-2938R | Recombinant Rat HSDL2 Protein | +Inquiry |
HSDL2-10002Z | Recombinant Zebrafish HSDL2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSDL2-820HCL | Recombinant Human HSDL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSDL2 Products
Required fields are marked with *
My Review for All HSDL2 Products
Required fields are marked with *
0
Inquiry Basket