Recombinant Full Length Human HSPA2 Protein, C-Flag-tagged
Cat.No. : | HSPA2-1605HFL |
Product Overview : | Recombinant Full Length Human HSPA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables disordered domain specific binding activity; enzyme binding activity; and unfolded protein binding activity. Involved in negative regulation of inclusion body assembly and protein refolding. Located in cytosol. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.8 kDa |
AA Sequence : | MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFD AKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKV HSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDV SILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSS TQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQ KLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILN VTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEK LRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGAS GGPTIEEVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency |
Protein Pathways : | Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Spliceosome |
Full Length : | Full L. |
Gene Name | HSPA2 heat shock protein family A (Hsp70) member 2 [ Homo sapiens (human) ] |
Official Symbol | HSPA2 |
Synonyms | HSP70-2; HSP70-3 |
Gene ID | 3306 |
mRNA Refseq | NM_021979.4 |
Protein Refseq | NP_068814.2 |
MIM | 140560 |
UniProt ID | P54652 |
◆ Recombinant Proteins | ||
HSPA2-1118H | Recombinant Human HSPA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPA2-4356M | Recombinant Mouse HSPA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPA2-0700H | Recombinant Human HSPA2 Protein (S2-D639), His tagged | +Inquiry |
HSPA2-3607H | Recombinant Human HSPA2 Protein (Ser2-Glu98), N-His tagged | +Inquiry |
HSPA2-0699H | Recombinant Human HSPA2 Protein (S2-D639), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPA2-5355HCL | Recombinant Human HSPA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSPA2 Products
Required fields are marked with *
My Review for All HSPA2 Products
Required fields are marked with *
0
Inquiry Basket