Recombinant Full Length Human HSPB11 Protein, GST-tagged

Cat.No. : HSPB11-3965HF
Product Overview : Human HSPB11 full-length ORF (AAH05245.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 144 amino acids
Description : HSPB11 (Heat Shock Protein Family B (Small) Member 11) is a Protein Coding gene. Among its related pathways are Organelle biogenesis and maintenance and Intraflagellar transport.
Molecular Mass : 42.24 kDa
AA Sequence : MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSPB11 heat shock protein family B (small), member 11 [ Homo sapiens ]
Official Symbol HSPB11
Synonyms HSPB11; heat shock protein family B (small), member 11; C1orf41, chromosome 1 open reading frame 41; heat shock protein beta-11; HSPCO34; IFT25; intraflagellar transport 25 homolog (Chlamydomonas); PP25; placental protein 25; intraflagellar transport 25 homolog; C1orf41;
Gene ID 51668
mRNA Refseq NM_016126
Protein Refseq NP_057210
UniProt ID Q9Y547

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPB11 Products

Required fields are marked with *

My Review for All HSPB11 Products

Required fields are marked with *

0
cart-icon
0
compare icon