Recombinant Full Length Human HSPBP1 Protein, GST-tagged

Cat.No. : HSPBP1-3972HF
Product Overview : Human HSPBP1 full-length ORF ( NP_036399.3, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 359 amino acids
Description : HSPBP1 (HSPA (Hsp70) Binding Protein 1) is a Protein Coding gene. Among its related pathways are Mechanisms of CFTR activation by S-nitrosoglutathione (normal and CF) and Protein processing in endoplasmic reticulum. GO annotations related to this gene include binding and enzyme inhibitor activity.
Molecular Mass : 65.7 kDa
AA Sequence : MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSPBP1 HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1 [ Homo sapiens ]
Official Symbol HSPBP1
Synonyms HSPBP1; HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1; hsp70-binding protein 1; FES1; Hsp70 binding protein 1; hsp70 interacting protein; HspBP1; hspBP2; hsp70-binding protein 2; hsp70-interacting protein 1; hsp70-interacting protein 2; heat shock protein-binding protein 1;
Gene ID 23640
mRNA Refseq NM_001130106
Protein Refseq NP_001123578
MIM 612939
UniProt ID Q9NZL4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPBP1 Products

Required fields are marked with *

My Review for All HSPBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon