Recombinant Full Length Human HSPBP1 Protein, GST-tagged
| Cat.No. : | HSPBP1-3972HF |
| Product Overview : | Human HSPBP1 full-length ORF ( NP_036399.3, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 359 amino acids |
| Description : | HSPBP1 (HSPA (Hsp70) Binding Protein 1) is a Protein Coding gene. Among its related pathways are Mechanisms of CFTR activation by S-nitrosoglutathione (normal and CF) and Protein processing in endoplasmic reticulum. GO annotations related to this gene include binding and enzyme inhibitor activity. |
| Molecular Mass : | 65.7 kDa |
| AA Sequence : | MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSPBP1 HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1 [ Homo sapiens ] |
| Official Symbol | HSPBP1 |
| Synonyms | HSPBP1; HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1; hsp70-binding protein 1; FES1; Hsp70 binding protein 1; hsp70 interacting protein; HspBP1; hspBP2; hsp70-binding protein 2; hsp70-interacting protein 1; hsp70-interacting protein 2; heat shock protein-binding protein 1; |
| Gene ID | 23640 |
| mRNA Refseq | NM_001130106 |
| Protein Refseq | NP_001123578 |
| MIM | 612939 |
| UniProt ID | Q9NZL4 |
| ◆ Recombinant Proteins | ||
| HSPBP1-5126H | Recombinant Human HSPBP1 Protein, GST-tagged | +Inquiry |
| HSPBP1-1540H | Recombinant Human HSPBP1, T7-tagged | +Inquiry |
| HSPBP1-2956R | Recombinant Rat HSPBP1 Protein | +Inquiry |
| HSPBP1-0568H | Recombinant Human HSPBP1 Protein (R84-R359), His tagged | +Inquiry |
| HSPBP1-2408H | Recombinant Human HSPBP1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPBP1-5342HCL | Recombinant Human HSPBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPBP1 Products
Required fields are marked with *
My Review for All HSPBP1 Products
Required fields are marked with *



