Recombinant Full Length Human HSPE1 Protein, GST-tagged
| Cat.No. : | HSPE1-5653HF |
| Product Overview : | Human HSPE1 full-length ORF ( AAH23518, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 102 amino acids |
| Description : | This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. [provided by RefSeq |
| Molecular Mass : | 36.96 kDa |
| AA Sequence : | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSPE1 heat shock 10kDa protein 1 (chaperonin 10) [ Homo sapiens ] |
| Official Symbol | HSPE1 |
| Synonyms | HSPE1; heat shock 10kDa protein 1 (chaperonin 10); heat shock 10kD protein 1 (chaperonin 10); 10 kDa heat shock protein, mitochondrial; CPN10; GROES; chaperonin 10; 10 kDa chaperonin; early-pregnancy factor; EPF; HSP10; |
| Gene ID | 3336 |
| mRNA Refseq | NM_002157 |
| Protein Refseq | NP_002148 |
| MIM | 600141 |
| UniProt ID | P61604 |
| ◆ Recombinant Proteins | ||
| HSPE1-1616H | Recombinant Human/Mouse/Goat HSPE1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| Hspe1-1193M | Recombinant Mouse Hspe1 Protein, MYC/DDK-tagged | +Inquiry |
| HSPE1-5043H | Recombinant Human Heat Shock 10 KDa Protein 1 (Chaperonin 10) | +Inquiry |
| HSPE1-3679H | Recombinant Human, HSPE1 His-tagged | +Inquiry |
| HSPE1-3092H | Recombinant Human HSPE1 Protein (Met1-Asp102), C-Fc tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPE1-5339HCL | Recombinant Human HSPE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPE1 Products
Required fields are marked with *
My Review for All HSPE1 Products
Required fields are marked with *
