Recombinant Full Length Human HYAL3 Protein, GST-tagged
Cat.No. : | HYAL3-5727HF |
Product Overview : | Human HYAL3 full-length ORF ( AAH05896, 1 a.a. - 417 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 417 amino acids |
Description : | This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. [provided by RefSeq |
Molecular Mass : | 71.61 kDa |
AA Sequence : | MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HYAL3 hyaluronoglucosaminidase 3 [ Homo sapiens ] |
Official Symbol | HYAL3 |
Synonyms | HYAL3; hyaluronoglucosaminidase 3; hyaluronidase-3; LUCA 3; LUCA14; Minna14; lung carcinoma protein 3; LUCA3; HYAL-3; LUCA-3; |
Gene ID | 8372 |
mRNA Refseq | NM_001200029 |
Protein Refseq | NP_001186958 |
MIM | 604038 |
UniProt ID | O43820 |
◆ Recombinant Proteins | ||
HYAL3-5220H | Recombinant Human HYAL3 Protein, GST-tagged | +Inquiry |
HYAL3-2631R | Recombinant Rat HYAL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HYAL3-2976R | Recombinant Rat HYAL3 Protein | +Inquiry |
HYAL3-6839Z | Recombinant Zebrafish HYAL3 | +Inquiry |
HYAL3-7954M | Recombinant Mouse HYAL3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HYAL3-831HCL | Recombinant Human HYAL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HYAL3 Products
Required fields are marked with *
My Review for All HYAL3 Products
Required fields are marked with *