Recombinant Full Length Human HYPK Protein, C-Flag-tagged
| Cat.No. : | HYPK-2006HFL |
| Product Overview : | Recombinant Full Length Human HYPK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables protein N-terminus binding activity. Involved in negative regulation of apoptotic process and protein stabilization. Located in cytoplasm; microtubule cytoskeleton; and nucleoplasm. Part of protein-containing complex. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 14.5 kDa |
| AA Sequence : | MRRRGEIDMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDR RSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALTN myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | HYPK huntingtin interacting protein K [ Homo sapiens (human) ] |
| Official Symbol | HYPK |
| Synonyms | HSPC136; C15orf63 |
| Gene ID | 25764 |
| mRNA Refseq | NM_016400.4 |
| Protein Refseq | NP_057484.4 |
| MIM | 612784 |
| UniProt ID | Q9NX55 |
| ◆ Recombinant Proteins | ||
| HYPK-1156H | Recombinant Human HYPK | +Inquiry |
| HYPK-2181R | Recombinant Rhesus monkey HYPK Protein, His-tagged | +Inquiry |
| HYPK-2002R | Recombinant Rhesus Macaque HYPK Protein, His (Fc)-Avi-tagged | +Inquiry |
| Hypk-1399M | Recombinant Mouse Hypk Protein, Myc/DDK-tagged | +Inquiry |
| HYPK-6791Z | Recombinant Zebrafish HYPK | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HYPK-8260HCL | Recombinant Human C15orf63 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HYPK Products
Required fields are marked with *
My Review for All HYPK Products
Required fields are marked with *




