Recombinant Full Length Human ICA1 Protein, C-Flag-tagged
Cat.No. : | ICA1-845HFL |
Product Overview : | Recombinant Full Length Human ICA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.5 kDa |
AA Sequence : | MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCL DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV ETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMD VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKE EKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSE EGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQT GSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Type I diabetes mellitus |
Full Length : | Full L. |
Gene Name | ICA1 islet cell autoantigen 1 [ Homo sapiens (human) ] |
Official Symbol | ICA1 |
Synonyms | ICA69; ICAp69 |
Gene ID | 3382 |
mRNA Refseq | NM_004968.4 |
Protein Refseq | NP_004959.2 |
MIM | 147625 |
UniProt ID | Q05084 |
◆ Recombinant Proteins | ||
ICA1-3061H | Recombinant Human ICA1 protein, His-tagged | +Inquiry |
Ica1-26M | Recombinant Mouse Ica1 protein, His-tagged | +Inquiry |
ICA1-2762H | Recombinant Human ICA1 protein, His&Myc-tagged | +Inquiry |
ICA1-2004R | Recombinant Rhesus Macaque ICA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ICA1-828Z | Recombinant Zebrafish ICA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICA1-5316HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
ICA1-5315HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ICA1 Products
Required fields are marked with *
My Review for All ICA1 Products
Required fields are marked with *
0
Inquiry Basket