Recombinant Full Length Human Icos Ligand(Icoslg) Protein, His-Tagged
| Cat.No. : | RFL36461HF |
| Product Overview : | Recombinant Full Length Human ICOS ligand(ICOSLG) Protein (O75144) (19-302aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (19-302) |
| Form : | Lyophilized powder |
| AA Sequence : | DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ICOSLG |
| Synonyms | ICOSLG; B7H2; B7RP1; ICOSL; KIAA0653; ICOS ligand; B7 homolog 2; B7-H2; B7-like protein Gl50; B7-related protein 1; B7RP-1; CD antigen CD275 |
| UniProt ID | O75144 |
| ◆ Recombinant Proteins | ||
| ICOSLG-3349H | Recombinant Human ICOSLG protein, His-tagged | +Inquiry |
| ICOSLG-1213H | Active Recombinant Human ICOSLG, MIgG2a Fc-tagged | +Inquiry |
| ICOSLG-039H | Recombinant Human ICOSLG Protein, His-tagged | +Inquiry |
| ICOSLG-1232CAF555 | Recombinant Cynomolgus ICOSLG Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| ICOSLG-1232CAF488 | Recombinant Cynomolgus ICOSLG Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ICOSLG-2804MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
| ICOSLG-1095HCL | Recombinant Human ICOSLG cell lysate | +Inquiry |
| ICOSLG-2618MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICOSLG Products
Required fields are marked with *
My Review for All ICOSLG Products
Required fields are marked with *
