Recombinant Full Length Human IFNA1 Protein, C-Flag-tagged
Cat.No. : | IFNA1-1816HFL |
Product Overview : | Recombinant Full Length Human IFNA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.3 kDa |
AA Sequence : | MASPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQ FQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSI LAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | IFNA1 interferon alpha 1 [ Homo sapiens (human) ] |
Official Symbol | IFNA1 |
Synonyms | IFL; IFN; IFNA@; IFNA13; leIF D; IFN-ALPHA; IFN-alphaD |
Gene ID | 3439 |
mRNA Refseq | NM_024013.3 |
Protein Refseq | NP_076918.1 |
MIM | 147660 |
UniProt ID | P01562 |
◆ Recombinant Proteins | ||
IFNA1-0876H | Recombinant Human IFNA1 Protein (C24-E189), Flag/His tagged | +Inquiry |
Ifna1-434M | Active Recombinant Mouse Ifna1 | +Inquiry |
IFNA1-188H | Recombinant Human IFNA1 Protein, His-tagged | +Inquiry |
IFNA1-01P | Recombinant Porcine IFNA1 Protein, His-tagged | +Inquiry |
IFNA1-1147H | Recombinant Human IFNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA1-1513RCL | Recombinant Rat IFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA1 Products
Required fields are marked with *
My Review for All IFNA1 Products
Required fields are marked with *
0
Inquiry Basket