Recombinant Full Length Human IGFBPL1 Protein, C-Flag-tagged
Cat.No. : | IGFBPL1-667HFL |
Product Overview : | Recombinant Full Length Human IGFBPL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable insulin-like growth factor binding activity. Involved in cellular response to tumor cell. Located in extracellular space. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.8 kDa |
AA Sequence : | MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISALDECGCCARCL GAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHP GHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVN IAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | IGFBPL1 insulin like growth factor binding protein like 1 [ Homo sapiens (human) ] |
Official Symbol | IGFBPL1 |
Synonyms | IGFBPRP4; IGFBP-RP4; bA113O24.1 |
Gene ID | 347252 |
mRNA Refseq | NM_001007563.3 |
Protein Refseq | NP_001007564.1 |
MIM | 610413 |
UniProt ID | Q8WX77 |
◆ Recombinant Proteins | ||
Igfbpl1-3491M | Recombinant Mouse Igfbpl1 Protein, Myc/DDK-tagged | +Inquiry |
IGFBPL1-8078M | Recombinant Mouse IGFBPL1 Protein | +Inquiry |
IGFBPL1 -504H | Recombinant Human IGFBPL1 Protein, MYC/DDK-tagged | +Inquiry |
IGFBPL1-1159H | Recombinant Human IGFBPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Igfbpl1-4470M | Recombinant Mouse Igfbpl1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGFBPL1 Products
Required fields are marked with *
My Review for All IGFBPL1 Products
Required fields are marked with *
0
Inquiry Basket