Recombinant Full Length Human IGFBPL1 Protein, C-Flag-tagged

• Cat.No.: IGFBPL1-667HFL
• Product Overview: Recombinant Full Length Human IGFBPL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable insulin-like growth factor binding activity. Involved in cellular response to tumor cell. Located in extracellular space.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 28.8 kDa
• AA Sequence: MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISALDECGCCARCL GAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHP GHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVN IAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: IGFBPL1 insulin like growth factor binding protein like 1 [ Homo sapiens (human) ]
• Official Symbol: IGFBPL1
• Synonyms: IGFBPRP4; IGFBP-RP4; bA113O24.1
• Gene ID: 347252
• mRNA Refseq: NM_001007563.3
• Protein Refseq: NP_001007564.1
• MIM: 610413
• UniProt ID: Q8WX77