Recombinant Full Length Human IGLON5 Protein, C-Flag-tagged
Cat.No. : | IGLON5-1943HFL |
Product Overview : | Recombinant Full Length Human IGLON5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be located in extracellular region. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MPPPAPGARLRLLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHVTRVAWLNRSN ILYAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISS PVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRV LVTVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFAN VSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPGLLALLSALGWLWWRM myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | IGLON5 IgLON family member 5 [ Homo sapiens (human) ] |
Official Symbol | IGLON5 |
Gene ID | 402665 |
mRNA Refseq | NM_001101372.3 |
Protein Refseq | NP_001094842.1 |
MIM | 618861 |
UniProt ID | A6NGN9 |
◆ Recombinant Proteins | ||
IGLON5-4476M | Recombinant Mouse IGLON5 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGLON5-505H | Recombinant Human IGLON5 Protein, MYC/DDK-tagged | +Inquiry |
Iglon5-3492M | Recombinant Mouse Iglon5 Protein, Myc/DDK-tagged | +Inquiry |
IGLON5-1943HFL | Recombinant Full Length Human IGLON5 Protein, C-Flag-tagged | +Inquiry |
IGLON5-8083M | Recombinant Mouse IGLON5 Protein | +Inquiry |
◆ Native Proteins | ||
IGLON5-13H | Recombinant Human IGLON5 Protein, Fc tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGLON5 Products
Required fields are marked with *
My Review for All IGLON5 Products
Required fields are marked with *