Recombinant Full Length Human IMMP1L Protein, GST-tagged
| Cat.No. : | IMMP1L-5801HF |
| Product Overview : | Human IMMP1L full-length ORF ( NP_659418.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 166 amino acids |
| Description : | The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 and IMP2 (IMMP2L; MIM 605977) are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM |
| Molecular Mass : | 44.9 kDa |
| AA Sequence : | MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IMMP1L IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | IMMP1L |
| Synonyms | IMP1; IMP1-LIKE; IMMP1L; IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae) |
| Gene ID | 196294 |
| mRNA Refseq | NM_144981 |
| Protein Refseq | NP_659418 |
| MIM | 612323 |
| UniProt ID | Q96LU5 |
| ◆ Recombinant Proteins | ||
| IMMP1L-5801HF | Recombinant Full Length Human IMMP1L Protein, GST-tagged | +Inquiry |
| IMMP1L-5153H | Recombinant Human IMMP1L Protein, GST-tagged | +Inquiry |
| IMMP1L-101H | Recombinant Human IMMP1L protein, His-tagged | +Inquiry |
| IMMP1L-5219C | Recombinant Chicken IMMP1L | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IMMP1L-5217HCL | Recombinant Human IMMP1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IMMP1L Products
Required fields are marked with *
My Review for All IMMP1L Products
Required fields are marked with *
