Recombinant Human IMMP1L Protein, GST-tagged
Cat.No. : | IMMP1L-5153H |
Product Overview : | Human IMMP1L full-length ORF ( NP_659418.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 and IMP2 (IMMP2L; MIM 605977) are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IMMP1L IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | IMMP1L |
Synonyms | IMP1; IMP1-LIKE; IMMP1L; IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae) |
Gene ID | 196294 |
mRNA Refseq | NM_144981 |
Protein Refseq | NP_659418 |
MIM | 612323 |
UniProt ID | Q96LU5 |
◆ Recombinant Proteins | ||
IMMP1L-5219C | Recombinant Chicken IMMP1L | +Inquiry |
IMMP1L-5801HF | Recombinant Full Length Human IMMP1L Protein, GST-tagged | +Inquiry |
IMMP1L-101H | Recombinant Human IMMP1L protein, His-tagged | +Inquiry |
IMMP1L-5153H | Recombinant Human IMMP1L Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMMP1L-5217HCL | Recombinant Human IMMP1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IMMP1L Products
Required fields are marked with *
My Review for All IMMP1L Products
Required fields are marked with *
0
Inquiry Basket