Recombinant Full Length Human IMPA2 Protein, GST-tagged
| Cat.No. : | IMPA2-5860HF |
| Product Overview : | Human IMPA2 full-length ORF ( NP_055029.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 288 amino acids |
| Description : | This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. [provided by RefSeq, Jan 2011] |
| Molecular Mass : | 57.7 kDa |
| AA Sequence : | MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IMPA2 inositol(myo)-1(or 4)-monophosphatase 2 [ Homo sapiens ] |
| Official Symbol | IMPA2 |
| Synonyms | IMPA2; inositol(myo)-1(or 4)-monophosphatase 2; inositol monophosphatase 2; IMP 2; IMPase 2; inosine monophosphatase 2; myo-inositol monophosphatase A2; inositol monophosphatase 2 variant 1; inositol monophosphatase 2 variant 2; |
| Gene ID | 3613 |
| mRNA Refseq | NM_014214 |
| Protein Refseq | NP_055029 |
| MIM | 605922 |
| UniProt ID | O14732 |
| ◆ Recombinant Proteins | ||
| IMPA2-3057R | Recombinant Rat IMPA2 Protein | +Inquiry |
| IMPA2-5143H | Recombinant Human IMPA2 Protein, GST-tagged | +Inquiry |
| IMPA2-1611H | Recombinant Human IMPA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IMPA2-2713R | Recombinant Rat IMPA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Impa2-523M | Recombinant Mouse Impa2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IMPA2-5213HCL | Recombinant Human IMPA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IMPA2 Products
Required fields are marked with *
My Review for All IMPA2 Products
Required fields are marked with *
