Recombinant Full Length Human ING4 Protein, C-Flag-tagged
Cat.No. : | ING4-1670HFL |
Product Overview : | Recombinant Full Length Human ING4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.3 kDa |
AA Sequence : | MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | ING4 inhibitor of growth family member 4 [ Homo sapiens (human) ] |
Official Symbol | ING4 |
Synonyms | my036; p29ING4 |
Gene ID | 51147 |
mRNA Refseq | NM_016162.4 |
Protein Refseq | NP_057246.2 |
MIM | 608524 |
UniProt ID | Q9UNL4 |
◆ Recombinant Proteins | ||
ING4-2717H | Recombinant Human ING4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ING4-5878HF | Recombinant Full Length Human ING4 Protein, GST-tagged | +Inquiry |
ING4-455H | Recombinant Human ING4, His tagged | +Inquiry |
ING4-4127H | Recombinant Human ING4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ING4-4545M | Recombinant Mouse ING4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ING4-5206HCL | Recombinant Human ING4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ING4 Products
Required fields are marked with *
My Review for All ING4 Products
Required fields are marked with *
0
Inquiry Basket