Recombinant Full Length Human INPP5E Protein, C-Flag-tagged
Cat.No. : | INPP5E-489HFL |
Product Overview : | Recombinant Full Length Human INPP5E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. Studies of the mouse counterpart suggest that this protein may hydrolyze phosphatidylinositol 3,4,5-trisphosphate and phosphatidylinositol 3,5-bisphosphate on the cytoplasmic Golgi membrane and thereby regulate Golgi-vesicular trafficking. Mutations in this gene cause Joubert syndrome; a clinically and genetically heterogenous group of disorders characterized by midbrain-hindbrain malformation and various associated ciliopathies that include retinal dystrophy, nephronophthisis, liver fibrosis and polydactyly. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 70 kDa |
AA Sequence : | MPSKAENLRPSEPAPQPPEGRTLQGQLPGAPPAQRAGSPPDAPGSESPALACSTPATPSGEDPPARAAPI APRPPARPRLERALSLDDKGWRRRRFRGSQEDLEARNGTSPSRGSVQSEGPGAPAHSCSPPCLSTSLQEI PKSRGVLSSERGSPSSGGNPLSGVASSSPNLPHRDAAVAGSSPRLPSLLPPRPPPALSLDIASDSLRTAN KVDSDLADYKLRAQPLLVRAHSSLGPGRPRSPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLA SGALLGADELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWET RLQETLGPHYVLLSSAAHGVLYMSLFIRRDLIWFCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLF ITSHFTSGDGKVAERLLDYTRTVQALVLPRNVPDTNPYRSSAADVTTRFDEVFWFGDFNFRLSGGRTVVD ALLCQGLVVDVPALLQHDQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLY RSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQ ALQSQNSSTICSVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Full Length : | Full L. |
Gene Name | INPP5E inositol polyphosphate-5-phosphatase E [ Homo sapiens (human) ] |
Official Symbol | INPP5E |
Synonyms | CPD4; CORS1; JBTS1; MORMS; PPI5PIV; pharbin |
Gene ID | 56623 |
mRNA Refseq | NM_019892.6 |
Protein Refseq | NP_063945.2 |
MIM | 613037 |
UniProt ID | Q9NRR6 |
◆ Recombinant Proteins | ||
INPP5E-2276R | Recombinant Rhesus monkey INPP5E Protein, His-tagged | +Inquiry |
INPP5E-5974HF | Recombinant Full Length Human INPP5E Protein, GST-tagged | +Inquiry |
INPP5E-5105H | Recombinant Human INPP5E Protein, GST-tagged | +Inquiry |
INPP5E-2396H | Recombinant Human INPP5E Protein, MYC/DDK-tagged | +Inquiry |
INPP5E-5933Z | Recombinant Zebrafish INPP5E | +Inquiry |
◆ Cell & Tissue Lysates | ||
INPP5E-862HCL | Recombinant Human INPP5E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INPP5E Products
Required fields are marked with *
My Review for All INPP5E Products
Required fields are marked with *
0
Inquiry Basket