Recombinant Full Length Human Integral Membrane Protein 2A(Itm2A) Protein, His-Tagged
Cat.No. : | RFL4836HF |
Product Overview : | Recombinant Full Length Human Integral membrane protein 2A(ITM2A) Protein (O43736) (1-263aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-263) |
Form : | Lyophilized powder |
AA Sequence : | MVKIAFNTPTAVQKEEARQDVEALLSRTVRTQILTGKELRVATQEKEGSSGRCMLTLLGL SFILAGLIVGGACIYKYFMPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIRED DNIAIIDVPVPSFSDSDPAAIIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELF GKLASGRYLPQTYVVREDLVAVEEIRDVSNLGIFIYQLCNNRKSFRLRRRDLLLGFNKRA IDKCWKIRHFPNEFIVETKICQE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ITM2A |
Synonyms | ITM2A; UNQ603/PRO1189; Integral membrane protein 2A; Protein E25 |
UniProt ID | O43736 |
◆ Recombinant Proteins | ||
ITM2A-5820HF | Recombinant Full Length Human ITM2A Protein, GST-tagged | +Inquiry |
ITM2A-1943C | Recombinant Chicken ITM2A | +Inquiry |
ITM2A-2319R | Recombinant Rhesus monkey ITM2A Protein, His-tagged | +Inquiry |
ITM2A-4955H | Recombinant Human ITM2A Protein, GST-tagged | +Inquiry |
Itm2a-4337M | Recombinant Mouse Itm2a Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ITM2A-001H | Recombinant Human ITM2A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITM2A-5118HCL | Recombinant Human ITM2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITM2A Products
Required fields are marked with *
My Review for All ITM2A Products
Required fields are marked with *