Recombinant Full Length Human Interferon Alpha-Inducible Protein 27, Mitochondrial(Ifi27) Protein, His-Tagged
| Cat.No. : | RFL35393HF |
| Product Overview : | Recombinant Full Length Human Interferon alpha-inducible protein 27, mitochondrial(IFI27) Protein (P40305) (34-119aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (34-119) |
| Form : | Lyophilized powder |
| AA Sequence : | ATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGA TGLSGLTKFILGSIGSAIAAVIARFY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | IFI27 |
| Synonyms | IFI27; Interferon alpha-inducible protein 27, mitochondrial; p27; Interferon alpha-induced 11.5 kDa protein; Interferon-stimulated gene 12a protein; ISG12(a; ISG12A |
| UniProt ID | P40305 |
| ◆ Recombinant Proteins | ||
| IFI27-2019R | Recombinant Rhesus Macaque IFI27 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IFI27-2198R | Recombinant Rhesus monkey IFI27 Protein, His-tagged | +Inquiry |
| RFL35393HF | Recombinant Full Length Human Interferon Alpha-Inducible Protein 27, Mitochondrial(Ifi27) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFI27-5296HCL | Recombinant Human IFI27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI27 Products
Required fields are marked with *
My Review for All IFI27 Products
Required fields are marked with *
