Recombinant Full Length Human Interferon-Induced Transmembrane Protein 5(Ifitm5) Protein, His-Tagged
| Cat.No. : | RFL12357HF |
| Product Overview : | Recombinant Full Length Human Interferon-induced transmembrane protein 5(IFITM5) Protein (A6NNB3) (1-132aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-132) |
| Form : | Lyophilized powder |
| AA Sequence : | MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYS IKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAA FFSTKFDDADYD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | IFITM5 |
| Synonyms | IFITM5; Interferon-induced transmembrane protein 5; Bone-restricted interferon-induced transmembrane protein-like protein; BRIL; Dispanin subfamily A member 1; DSPA1 |
| UniProt ID | A6NNB3 |
| ◆ Recombinant Proteins | ||
| RFL15549MF | Recombinant Full Length Mouse Interferon-Induced Transmembrane Protein 5(Ifitm5) Protein, His-Tagged | +Inquiry |
| IFITM5-726H | Recombinant Human IFITM5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IFITM5-4438M | Recombinant Mouse IFITM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IFITM5-1146H | Recombinant Human IFITM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ifitm5-3481M | Recombinant Mouse Ifitm5 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFITM5 Products
Required fields are marked with *
My Review for All IFITM5 Products
Required fields are marked with *
