Recombinant Full Length Human IRF8 Protein, C-Flag-tagged
Cat.No. : | IRF8-1536HFL |
Product Overview : | Recombinant Full Length Human IRF8 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Interferon consensus sequence-binding protein (ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEG DKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGR SEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFY YGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLL HSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCF GEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRE NQQITVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | IRF8 interferon regulatory factor 8 [ Homo sapiens (human) ] |
Official Symbol | IRF8 |
Synonyms | ICSBP; IRF-8; ICSBP1; IMD32A; IMD32B; H-ICSBP |
Gene ID | 3394 |
mRNA Refseq | NM_002163.4 |
Protein Refseq | NP_002154.1 |
MIM | 601565 |
UniProt ID | Q02556 |
◆ Recombinant Proteins | ||
IRF8-586M | Recombinant Mouse IRF8 Protein (1-424 aa), His-SUMO-tagged | +Inquiry |
IRF8-2301R | Recombinant Rhesus monkey IRF8 Protein, His-tagged | +Inquiry |
IRF8-8306M | Recombinant Mouse IRF8 Protein | +Inquiry |
IRF8-1201H | Recombinant Human IRF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF8-3094H | Recombinant Human IRF8 Protein (Gly128-Val426), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF8-5159HCL | Recombinant Human IRF8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF8 Products
Required fields are marked with *
My Review for All IRF8 Products
Required fields are marked with *
0
Inquiry Basket