Recombinant Full Length Human ITM2B Protein, GST-tagged
Cat.No. : | ITM2B-5823HF |
Product Overview : | Human ITM2B full-length ORF ( NP_068839.1, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 266 amino acids |
Description : | Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by furin or furin-like proteases to produce a small secreted peptide which inhibits the deposition of beta-amyloid. Mutations which result in extension of the C-terminal end of the encoded protein, thereby increasing the size of the secreted peptide, are associated with two neurogenerative diseases, familial British dementia and familial Danish dementia. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 56.7 kDa |
AA Sequence : | MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITM2B integral membrane protein 2B [ Homo sapiens ] |
Official Symbol | ITM2B |
Synonyms | ITM2B; integral membrane protein 2B; BRI; E3 16; E25B; ABri/ADan amyloid peptide; transmembrane protein BRI; BRICHOS domain containing 2B; FBD; ABRI; BRI2; E3-16; BRICD2B; |
Gene ID | 9445 |
mRNA Refseq | NM_021999 |
Protein Refseq | NP_068839 |
MIM | 603904 |
UniProt ID | Q9Y287 |
◆ Cell & Tissue Lysates | ||
ITM2B-5117HCL | Recombinant Human ITM2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITM2B Products
Required fields are marked with *
My Review for All ITM2B Products
Required fields are marked with *
0
Inquiry Basket