Recombinant Full Length Human Jnk1/Mapk8-Associated Membrane Protein(Jkamp) Protein, His-Tagged
| Cat.No. : | RFL18843HF |
| Product Overview : | Recombinant Full Length Human JNK1/MAPK8-associated membrane protein(JKAMP) Protein (Q9P055) (1-326aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-326) |
| Form : | Lyophilized powder |
| AA Sequence : | MFGAAARSADLALLEKNLQAAHGCLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKY CQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIIT LLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCL VLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLS LVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVP TPALFYLFTAKFTEPSRILSEGANGH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | JKAMP |
| Synonyms | JKAMP; C14orf100; JAMP; CDA06; HSPC213; HSPC327; JNK1/MAPK8-associated membrane protein; JKAMP; JNK1-associated membrane protein; Medulloblastoma antigen MU-MB-50.4 |
| UniProt ID | Q9P055 |
| ◆ Recombinant Proteins | ||
| JKAMP-2330R | Recombinant Rhesus monkey JKAMP Protein, His-tagged | +Inquiry |
| JKAMP-10780Z | Recombinant Zebrafish JKAMP | +Inquiry |
| RFL18843HF | Recombinant Full Length Human Jnk1/Mapk8-Associated Membrane Protein(Jkamp) Protein, His-Tagged | +Inquiry |
| JKAMP-4676M | Recombinant Mouse JKAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL15838MF | Recombinant Full Length Mouse Jnk1/Mapk8-Associated Membrane Protein(Jkamp) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| JKAMP-5103HCL | Recombinant Human JKAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JKAMP Products
Required fields are marked with *
My Review for All JKAMP Products
Required fields are marked with *
