Recombinant Full Length Human JOSD1 Protein, C-Flag-tagged
Cat.No. : | JOSD1-1649HFL |
Product Overview : | Recombinant Full Length Human JOSD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable thiol-dependent deubiquitinase. Predicted to be involved in protein deubiquitination. Located in membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23 kDa |
AA Sequence : | MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVT PHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHW ICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | JOSD1 Josephin domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | JOSD1 |
Synonyms | dJ508I15.2 |
Gene ID | 9929 |
mRNA Refseq | NM_014876.7 |
Protein Refseq | NP_055691.1 |
MIM | 615323 |
UniProt ID | Q15040 |
◆ Recombinant Proteins | ||
JOSD1-175H | Active Recombinant Human JOSD1, His-tagged | +Inquiry |
JOSD1-0360H | Recombinant Human JOSD1 Protein (S2-V202), GST tagged | +Inquiry |
JOSD1-2153R | Recombinant Rhesus Macaque JOSD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
JOSD1-1822H | Recombinant Human JOSD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
JOSD1-8428M | Recombinant Mouse JOSD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
JOSD1-5099HCL | Recombinant Human JOSD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JOSD1 Products
Required fields are marked with *
My Review for All JOSD1 Products
Required fields are marked with *
0
Inquiry Basket