Recombinant Full Length Human KDM8 Protein, C-Flag-tagged
Cat.No. : | KDM8-1949HFL |
Product Overview : | Recombinant Full Length Human KDM8 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MSREKCSPGEGAEEGRGSEASGLKASAGHGTEPAGGGPMAGDTHCPAEPLAREGTLWEALRALLPHSKED LKLDLGEKVERSVVTLLQRATELFYEGRRDECLQSSEVILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLK ALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLKVAAILQTHLPGKRPARGSLPEQPCTKKARADH GLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSR YTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFG PQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFL SCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | KDM8 lysine demethylase 8 [ Homo sapiens (human) ] |
Official Symbol | KDM8 |
Synonyms | JMJD5 |
Gene ID | 79831 |
mRNA Refseq | NM_001145348.2 |
Protein Refseq | NP_001138820 |
MIM | 611917 |
UniProt ID | Q8N371 |
◆ Recombinant Proteins | ||
KDM8-4864HF | Recombinant Full Length Human KDM8 Protein, GST-tagged | +Inquiry |
KDM8-6178H | Recombinant Human KDM8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
JMJD5-206H | Recombinant Human JMJD5 protein, His-tagged | +Inquiry |
KDM8-2894R | Recombinant Rat KDM8 Protein, His (Fc)-Avi-tagged | +Inquiry |
KDM8-6081Z | Recombinant Zebrafish KDM8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDM8-5102HCL | Recombinant Human JMJD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDM8 Products
Required fields are marked with *
My Review for All KDM8 Products
Required fields are marked with *
0
Inquiry Basket