Recombinant Full Length Human KIAA0825 Protein, GST-tagged

Cat.No. : KIAA0825-3270HF
Product Overview : Human C5orf36 full-length ORF (NP_775936.1, 1 a.a. - 324 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 324 amino acids
Description : KIAA0825 (KIAA0825) is a Protein Coding gene.
Molecular Mass : 64 kDa
AA Sequence : MDWDDEYSHNSFDLHCLLNSFPGDLEFEQIFSDIDEKIEQNAASIKHCIKEIQSEINKQCPGVQLQTTTDCFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWDLSCHSSVSFPSTLSGTSFHFLSRTSLHSVEDNSSMDVKSMWDDIRLHLRRFLVSKLQSHNEINNSQQKILLKKQCLQQLLFLYPESEVIIKYQNIQNKLLANLLWNCFPSYNRDSNLDVIAHGYQSTMLKLYSVIKEDFNTLCEILAPSSMVKFIKETYLDTVTEEMAKFLENFCELQFRENAVRVVKTSKSSSKHRGAVHALG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KIAA0825 KIAA0825 [ Homo sapiens ]
Official Symbol KIAA0825
Synonyms KIAA0825; C5orf36, chromosome 5 open reading frame 36; uncharacterized protein KIAA0825; DKFZp686F0372; MGC34713; C5orf36; FLJ27431;
Gene ID 285600
mRNA Refseq NM_001145678
Protein Refseq NP_001139150
MIM 617266
UniProt ID Q8IV33

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIAA0825 Products

Required fields are marked with *

My Review for All KIAA0825 Products

Required fields are marked with *

0
cart-icon
0
compare icon