Recombinant Full Length Human KIAA0825 Protein, GST-tagged
| Cat.No. : | KIAA0825-3270HF |
| Product Overview : | Human C5orf36 full-length ORF (NP_775936.1, 1 a.a. - 324 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 324 amino acids |
| Description : | KIAA0825 (KIAA0825) is a Protein Coding gene. |
| Molecular Mass : | 64 kDa |
| AA Sequence : | MDWDDEYSHNSFDLHCLLNSFPGDLEFEQIFSDIDEKIEQNAASIKHCIKEIQSEINKQCPGVQLQTTTDCFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWDLSCHSSVSFPSTLSGTSFHFLSRTSLHSVEDNSSMDVKSMWDDIRLHLRRFLVSKLQSHNEINNSQQKILLKKQCLQQLLFLYPESEVIIKYQNIQNKLLANLLWNCFPSYNRDSNLDVIAHGYQSTMLKLYSVIKEDFNTLCEILAPSSMVKFIKETYLDTVTEEMAKFLENFCELQFRENAVRVVKTSKSSSKHRGAVHALG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KIAA0825 KIAA0825 [ Homo sapiens ] |
| Official Symbol | KIAA0825 |
| Synonyms | KIAA0825; C5orf36, chromosome 5 open reading frame 36; uncharacterized protein KIAA0825; DKFZp686F0372; MGC34713; C5orf36; FLJ27431; |
| Gene ID | 285600 |
| mRNA Refseq | NM_001145678 |
| Protein Refseq | NP_001139150 |
| MIM | 617266 |
| UniProt ID | Q8IV33 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIAA0825 Products
Required fields are marked with *
My Review for All KIAA0825 Products
Required fields are marked with *
