Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 2Dl1(Kir2Dl1) Protein, His-Tagged
Cat.No. : | RFL27193HF |
Product Overview : | Recombinant Full Length Human Killer cell immunoglobulin-like receptor 2DL1(KIR2DL1) Protein (P43626) (22-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-348) |
Form : | Lyophilized powder |
AA Sequence : | HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KIR2DL1 |
Synonyms | KIR2DL1; CD158A; NKAT1; Killer cell immunoglobulin-like receptor 2DL1; CD158 antigen-like family member A; MHC class I NK cell receptor; Natural killer-associated transcript 1; NKAT-1; p58 natural killer cell receptor clones CL-42/47.11; p58 NK receptor C |
UniProt ID | P43626 |
◆ Recombinant Proteins | ||
KIR2DL1-28651TH | Recombinant Human KIR2DL1 | +Inquiry |
KIR2DL1-496H | Recombinant Human KIR2DL1 protein, His-Avi-tagged | +Inquiry |
KIR2DL1-626HB | Recombinant Human KIR2DL1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
KIR2DL1-4335H | Recombinant Human KIR2DL1 Protein (Met1-His245), C-His tagged | +Inquiry |
KIR2DL1-7063H | Recombinant Human KIR2DL1 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DL1-1657HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
KIR2DL1-1701HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR2DL1 Products
Required fields are marked with *
My Review for All KIR2DL1 Products
Required fields are marked with *