Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 2Ds2(Kir2Ds2) Protein, His-Tagged
Cat.No. : | RFL5330HF |
Product Overview : | Recombinant Full Length Human Killer cell immunoglobulin-like receptor 2DS2(KIR2DS2) Protein (P43631) (22-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-304) |
Form : | Lyophilized powder |
AA Sequence : | HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KIR2DS2 |
Synonyms | KIR2DS2; CD158J; NKAT5; Killer cell immunoglobulin-like receptor 2DS2; CD158 antigen-like family member J; MHC class I NK cell receptor; NK receptor 183 ActI; Natural killer-associated transcript 5; NKAT-5; p58 natural killer cell receptor clone CL-49; p5 |
UniProt ID | P43631 |
◆ Recombinant Proteins | ||
RFL5330HF | Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 2Ds2(Kir2Ds2) Protein, His-Tagged | +Inquiry |
KIR2DS2-6466H | Recombinant Human KIR2DS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KIR2DS2-151H | Recombinant Human KIR2DS2 Protein, His-tagged | +Inquiry |
KIR2DS2-8191H | Recombinant Human KIR2DS2 protein, His & GST-tagged | +Inquiry |
KIR2DS2-06H | Recombinant Human KIR2DS2 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DS2-364HCL | Recombinant Human KIR2DS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIR2DS2 Products
Required fields are marked with *
My Review for All KIR2DS2 Products
Required fields are marked with *
0
Inquiry Basket