Recombinant Full Length Human KLRC4 Protein, GST-tagged
Cat.No. : | KLRC4-5907HF |
Product Overview : | Human KLRC4 full-length ORF ( AAH17784, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 158 amino acids |
Description : | Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC4 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. The 3 end of the KLRC4 transcript includes the first non-coding exon found at the 5 end of the adjacent D12S2489E gene transcript. [provided by RefSeq |
Molecular Mass : | 43.12 kDa |
AA Sequence : | MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLRC4 killer cell lectin-like receptor subfamily C, member 4 [ Homo sapiens ] |
Official Symbol | KLRC4 |
Synonyms | KLRC4; killer cell lectin-like receptor subfamily C, member 4; NKG2-F type II integral membrane protein; NKG2 F; NK cell receptor F; natual killer cell group 2-F; NKG2-F-activating NK receptor; NKG2F; NKG2-F; FLJ17759; FLJ78582; |
Gene ID | 8302 |
mRNA Refseq | NM_013431 |
Protein Refseq | NP_038459 |
MIM | 602893 |
UniProt ID | O43908 |
◆ Recombinant Proteins | ||
KLRC4-4912H | Recombinant Human KLRC4 Protein, GST-tagged | +Inquiry |
KLRC4-5907HF | Recombinant Full Length Human KLRC4 Protein, GST-tagged | +Inquiry |
RFL14264HF | Recombinant Full Length Human Nkg2-F Type Ii Integral Membrane Protein(Klrc4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRC4-4894HCL | Recombinant Human KLRC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRC4 Products
Required fields are marked with *
My Review for All KLRC4 Products
Required fields are marked with *