Recombinant Human KLRC4 Protein, GST-tagged

Cat.No. : KLRC4-4912H
Product Overview : Human KLRC4 full-length ORF ( AAH17784, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC4 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. The 3 end of the KLRC4 transcript includes the first non-coding exon found at the 5 end of the adjacent D12S2489E gene transcript. [provided by RefSeq
Molecular Mass : 43.12 kDa
AA Sequence : MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KLRC4 killer cell lectin-like receptor subfamily C, member 4 [ Homo sapiens ]
Official Symbol KLRC4
Synonyms KLRC4; killer cell lectin-like receptor subfamily C, member 4; NKG2-F type II integral membrane protein; NKG2 F; NK cell receptor F; natual killer cell group 2-F; NKG2-F-activating NK receptor; NKG2F; NKG2-F; FLJ17759; FLJ78582;
Gene ID 8302
mRNA Refseq NM_013431
Protein Refseq NP_038459
MIM 602893
UniProt ID O43908

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLRC4 Products

Required fields are marked with *

My Review for All KLRC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon