Recombinant Full Length Human KLRK1 Protein, GST-tagged

Cat.No. : KLRK1-5776HF
Product Overview : Human KLRK1 full-length ORF ( NP_031386.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 216 amino acids
Description : Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene encodes a member of the NKG2 family, and the encoded transmembrane protein is characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. [provided by RefSeq
Molecular Mass : 51.7 kDa
AA Sequence : MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KLRK1 killer cell lectin-like receptor subfamily K, member 1 [ Homo sapiens ]
Official Symbol KLRK1
Synonyms KLRK1; killer cell lectin-like receptor subfamily K, member 1; D12S2489E, DNA segment on chromosome 12 (unique) 2489 expressed sequence; NKG2-D type II integral membrane protein; CD314; KLR; NKG2 D; NKG2D; NK cell receptor D; NKG2-D-activating NK receptor; NKG2-D; D12S2489E; FLJ17759; FLJ75772;
Gene ID 22914
mRNA Refseq NM_007360
Protein Refseq NP_031386
MIM 611817
UniProt ID P26718

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLRK1 Products

Required fields are marked with *

My Review for All KLRK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon