Recombinant Full Length Human KRTAP13-3 Protein, GST-tagged
| Cat.No. : | KRTAP13-3-5803HF |
| Product Overview : | Human KRTAP13-3 full-length ORF ( NP_853653.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 172 amino acids |
| Description : | KRTAP13-3 (Keratin Associated Protein 13-3) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. An important paralog of this gene is KRTAP13-1. |
| Molecular Mass : | 45.6 kDa |
| AA Sequence : | MSYNCCSRNFSSCSHGGYLHYPGSSCGSSYPSNLVYSTDLCSPSTCQLGSSLYRGCQETCWRPNSCQTLCVESSPCHTSCYYPRTHMLCNSCLTMHVGSRGFGSNSCCSLSCGSRSCSSLGCGSNGFRYLNYRIHTSPSQSYRSRFCHPIYFPPRRWFHSSCYQPFCRSGFY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRTAP13-3 keratin associated protein 13-3 [ Homo sapiens (human) ] |
| Official Symbol | KRTAP13-3 |
| Synonyms | KRTAP13-3; keratin associated protein 13-3; KAP13.3; keratin-associated protein 13-3 |
| Gene ID | 337960 |
| mRNA Refseq | NM_181622 |
| Protein Refseq | NP_853653 |
| UniProt ID | Q3SY46 |
| ◆ Recombinant Proteins | ||
| KRTAP13-3-5803HF | Recombinant Full Length Human KRTAP13-3 Protein, GST-tagged | +Inquiry |
| KRTAP13-3-1540H | Recombinant Human KRTAP13-3 | +Inquiry |
| KRTAP13-3-4822H | Recombinant Human KRTAP13-3 Protein, GST-tagged | +Inquiry |
| KRTAP13-3-3267H | Recombinant Human KRTAP13-3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP13-3 Products
Required fields are marked with *
My Review for All KRTAP13-3 Products
Required fields are marked with *
