Recombinant Human KRTAP13-3 Protein, GST-tagged

Cat.No. : KRTAP13-3-4822H
Product Overview : Human KRTAP13-3 full-length ORF ( NP_853653.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-172 a.a.
Description : KRTAP13-3 (Keratin Associated Protein 13-3) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. An important paralog of this gene is KRTAP13-1.
Molecular Mass : 45.6 kDa
AA Sequence : MSYNCCSRNFSSCSHGGYLHYPGSSCGSSYPSNLVYSTDLCSPSTCQLGSSLYRGCQETCWRPNSCQTLCVESSPCHTSCYYPRTHMLCNSCLTMHVGSRGFGSNSCCSLSCGSRSCSSLGCGSNGFRYLNYRIHTSPSQSYRSRFCHPIYFPPRRWFHSSCYQPFCRSGFY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP13-3 keratin associated protein 13-3 [ Homo sapiens (human) ]
Official Symbol KRTAP13-3
Synonyms KRTAP13-3; keratin associated protein 13-3; KAP13.3; keratin-associated protein 13-3
Gene ID 337960
mRNA Refseq NM_181622
Protein Refseq NP_853653
UniProt ID Q3SY46

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP13-3 Products

Required fields are marked with *

My Review for All KRTAP13-3 Products

Required fields are marked with *

0
cart-icon
0
compare icon