Recombinant Human KRTAP13-3 Protein, GST-tagged

• Cat.No.: KRTAP13-3-4822H
• Product Overview: Human KRTAP13-3 full-length ORF ( NP_853653.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-172 a.a.
• Description: KRTAP13-3 (Keratin Associated Protein 13-3) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. An important paralog of this gene is KRTAP13-1.
• Molecular Mass: 45.6 kDa
• AA Sequence: MSYNCCSRNFSSCSHGGYLHYPGSSCGSSYPSNLVYSTDLCSPSTCQLGSSLYRGCQETCWRPNSCQTLCVESSPCHTSCYYPRTHMLCNSCLTMHVGSRGFGSNSCCSLSCGSRSCSSLGCGSNGFRYLNYRIHTSPSQSYRSRFCHPIYFPPRRWFHSSCYQPFCRSGFY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP13-3 keratin associated protein 13-3 [ Homo sapiens (human) ]
• Official Symbol: KRTAP13-3
• Synonyms: KRTAP13-3; keratin associated protein 13-3; KAP13.3; keratin-associated protein 13-3
• Gene ID: 337960
• mRNA Refseq: NM_181622
• Protein Refseq: NP_853653
• UniProt ID: Q3SY46