Recombinant Full Length Human KRTAP8-1 Protein, GST-tagged

• Cat.No.: KRTAP8-1-5832HF
• Product Overview: Human KRTAP8-1 full-length ORF ( ADR83447.1, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 63 amino acids
• Description: KRTAP8-1 (Keratin Associated Protein 8-1) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
• Molecular Mass: 7 kDa
• AA Sequence: MLCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGAFGYRRYSPFALY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP8-1 keratin associated protein 8-1 [ Homo sapiens ]
• Official Symbol: KRTAP8-1
• Synonyms: KAP8.1; KRTAP8-1; keratin associated protein 8-1
• Gene ID: 337879
• mRNA Refseq: NM_175857
• Protein Refseq: NP_787053
• UniProt ID: Q8IUC2