Recombinant Full Length Human LDHA Protein, GST-tagged
Cat.No. : | LDHA-6967HF |
Product Overview : | Recombinant full-length Human LDHA(1 a.a. - 332 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 332 amino acids |
Description : | The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. |
Molecular Mass : | 63.1 kDa |
AA Sequence : | MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTP KIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKI SGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKE QWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI SDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LDHA lactate dehydrogenase A [ Homo sapiens (human) ] |
Official Symbol | LDHA |
Synonyms | LDHA; lactate dehydrogenase A; LDH1; LDHM; GSD11; PIG19; L-lactate dehydrogenase A chain; LDH-A; LDH-M; LDH muscle subunit; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; cell proliferation-inducing gene 19 protein; EC 1.1.1.27 |
Gene ID | 3939 |
mRNA Refseq | NM_005566 |
Protein Refseq | NP_005557 |
MIM | 150000 |
UniProt ID | P00338 |
◆ Recombinant Proteins | ||
LDHA-8843Z | Recombinant Zebrafish LDHA | +Inquiry |
LDHA-30120H | Recombinant Human LDHA protein, GST-tagged | +Inquiry |
LDHA-4429H | Recombinant Human LDHA Protein (Met1-Phe332), N-His tagged | +Inquiry |
Ldha-1000M | Active Recombinant Mouse Ldha protein(Met1-Phe332), His-tagged | +Inquiry |
LDHA-1914S | Recombinant Staphylococcus Aureus LDHA Protein (1-317 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
LDHA-26867TH | Native Human LDHA | +Inquiry |
LDHA-8315C | Native Chicken LDHA | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHA-4790HCL | Recombinant Human LDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LDHA Products
Required fields are marked with *
My Review for All LDHA Products
Required fields are marked with *
0
Inquiry Basket